PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G151400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family LBD
Protein Properties Length: 166aa    MW: 18509.1 Da    PI: 7.1478
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G151400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.56.2e-4561051100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ 
  Aqcoe1G151400.1.p   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPIHQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVSQLQM 97 
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +la++++e
  Aqcoe1G151400.1.p  98 QLAVAQAE 105
                        ****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0875106IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-446103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MGGTSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK VFGASNVSKM LQELPIHQRA  60
DAVSSLVYEA NARVRDPVYG CVGAISYLQN QVSQLQMQLA VAQAEILCIQ MQQEPALPTH  120
HHQQIDDERS LLLHSNLDSI PQQYFNFASS SNVIQDPLKR ESLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257046.11e-106PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW39e-84LBD12_ARATH; LOB domain-containing protein 12
TrEMBLB9GH621e-101B9GH62_POPTR; LOB domain protein 12
STRINGPOPTR_0001s28840.11e-101(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.15e-85LBD family protein